Description
Chemical Identity
CJC-1295 DAC analytical reference compound. Molecular weight 3647.28 Da. Also known as: CJC-1295 with DAC, Drug Affinity Complex CJC-1295, Modified GRF(1-29) with DAC. Research status: Discontinued.
Research Overview
CJC-1295 DAC is a synthetic analog of growth hormone-releasing hormone (GHRH) conjugated with a Drug Affinity Complex (DAC) that binds albumin in vivo, extending its half-life from minutes to approximately 6-8 days. Clinical trials have demonstrated sustained elevation of growth hormone and IGF-1 levels with weekly dosing.
CJC-1295 DAC activates the GHRH receptor (GHRH-R), a G protein-coupled receptor expressed on somatotroph cells in the anterior pituitary gland. Binding to the GHRH-R triggers a signaling cascade involving cyclic AMP (cAMP) and protein kinase A (PKA), which stimulates both the synthesis of growth hormone at the transcriptional level and the exocytotic release of stored GH granules.
The Drug Affinity Complex component is a maleimido derivative of lysine that forms a covalent bond with albumin in the bloodstream after injection. This albumin conjugation serves two purposes: it protects the peptide from enzymatic degradation by dipeptidyl peptidase IV (DPP-IV) and other proteases, and it dramatically increases the effective molecular size, reducing renal clearance. The result is a half-life extension from approximately 30 minutes to 6 to 8 days.
Key published studies on CJC-1295 DAC include: “Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295, a long-acting analog of GH-releasing hormone, in healthy adults” (Journal of Clinical Endocrinology and Metabolism, 2006); “Pulsatile secretion of growth hormone (GH) persists during continuous stimulation by CJC-1295, a long-acting GH-releasing hormone analog” (Journal of Clinical Endocrinology and Metabolism, 2006); “Human growth hormone-releasing factor (hGRF)1-29-albumin bioconjugates activate the GRF receptor on the anterior pituitary in rats: identification of CJC-1295 as a long-lasting GRF analog” (Endocrinology, 2005). These findings should be interpreted within the context of the experimental models and conditions described in each publication.
Research Context
CJC-1295 DAC is a synthetic 30-amino acid peptide analog of growth hormone-releasing hormone (GHRH) that incorporates a proprietary Drug Affinity Complex (DAC) technology. This modification enables the peptide to bind to serum albumin after subcutaneous injection, dramatically extending its plasma half-life from approximately 30 minutes (for the unmodified peptide) to 6 to 8 days. This prolonged duration of action allows for once-weekly dosing while maintaining sustained stimulation of growth hormone (GH) release from the anterior pituitary.
The compound was developed by ConjuChem Biotechnologies (now ConjuChem LLC) as a potential therapeutic agent for conditions associated with growth hormone deficiency. It represents a significant pharmacological advancement over native GHRH and earlier GHRH analogs, which required frequent administration due to rapid proteolytic degradation.
CJC-1295 DAC functions as a GHRH receptor agonist, stimulating the somatotroph cells of the anterior pituitary to synthesize and release growth hormone. Unlike direct GH administration, CJC-1295 DAC preserves the physiological pulsatile pattern of GH release, as it amplifies the natural GHRH signaling rather than bypassing it. This is considered pharmacologically advantageous because it maintains the hypothalamic-pituitary feedback mechanisms that regulate GH homeostasis.
Specifications
| Sequence | YADAIFTQSYRKVLAQLSARKLLQDILSR-DAC |
| Molecular Weight | 3647.28 Da |
| Molecular Formula | C165H271N47O46 |
| CAS Number | 863288-34-0 |
| Purity | >=98% (HPLC) |
| Appearance | White to off-white lyophilized powder |
| Format | Lyophilized powder, sterile filtered |
| Solubility | Soluble in bacteriostatic water, sterile water, or normal saline |
| Storage | Store at -20°C (lyophilized). Reconstituted: 2-8°C, use within 30 days |
| Shipping | Ambient temperature (stable in lyophilized form) |
Each lot is accompanied by a Certificate of Analysis (COA) documenting purity, identity, and endotoxin testing results.
Research Applications
CJC-1295 DAC reference compound has been documented in the published scientific literature across the following in vitro and preclinical research areas:
- Growth hormone deficiency research
- Age-related GH decline investigatio
- Body composition research
- Anti-aging and longevity research
Researchers are advised to consult the primary literature for detailed experimental protocols, concentrations, and conditions relevant to their specific area of investigation involving CJC-1295 DAC.
Storage and Handling
CJC-1295 DAC is supplied as a lyophilized powder and should be stored at -20°C upon receipt for long-term stability. Protect from light, moisture, and repeated temperature fluctuations. Allow the sealed vial to equilibrate to room temperature before opening to prevent condensation and moisture absorption.
For reconstitution, add sterile water or an appropriate buffer slowly along the vial wall to avoid foaming. Gently swirl to dissolve — do not vortex. Reconstituted CJC-1295 DAC solutions should be stored at 2-8°C and used within 30 days. Aliquoting is recommended to minimize freeze-thaw cycles. Consult the Safety Data Sheet (SDS) for detailed handling and disposal guidance.
For laboratory research use only (in vitro). Not for human or animal use. Not for diagnostic, therapeutic, or clinical purposes. CJC-1295 DAC is supplied as an analytical reference compound for use by qualified research personnel at accredited institutions. Prescott Bio Canada does not provide guidance on administration, dosing, or use in living organisms.