Laboratory research materials for in vitro use only.

$20 flat-rate shipping across Canada  ·  Free shipping on orders over $350

IGF-1 LR3

For laboratory research use only (in vitro). Not for human or animal use.

$117.74Regular: $156.99Pre-order adjustment: −25%

Pre-Order — Currently Out of Stock

15% OFF Create an account and get 15% off your first order

Volume Pricing

QuantityDiscountUnit Price
1-2 unitsStandard$156.99Your price
3-4 units5% off$149.14Your price
5-9 units10% off$141.29Your price
10+ units Best Value15% off$133.44Your price

25% Pre-Order Discount Applied

The 25% pre-order discount is the maximum available and overrides volume pricing. There is no additional volume discount.

Pay via Interac e-Transfer

Why researchers choose PBC:

  • HPLC-verified purity on every lot
  • Certificate of Analysis included
  • Temperature-controlled shipping
  • Canadian lab — documented supply chain
  • Batch-level traceability

Accepted payment methods:

Interac e-Transfer

Certificate of Analysis available upon request. Contact us for lot-specific documentation.

Product Specifications

Amino Acid Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Weight 9111.4 Da
Molecular Formula C400H625N111O115S9
CAS Number 946870-92-4
Purity ≥98% (HPLC)
Format Lyophilized Powder
Net Quantity 1mg
Vials Per Kit 10
Storage Store at -20C. Reconstituted: 2-8C
Research Status Preclinical

For laboratory research use only (in vitro). Not for human or animal use.

Description

Chemical Identity

IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is an 83-amino acid analog of human IGF-1 with the molecular formula C400H625N111O115S9 and a molecular weight of 9111.4 Da (CAS number 946870-92-4). The compound features two key modifications from native IGF-1: an arginine substitution at position 3 (replacing glutamic acid) and a 13-amino acid N-terminal extension peptide derived from methionyl porcine growth hormone.

These modifications significantly reduce binding to the six known IGF binding proteins (IGFBPs), which normally sequester over 99% of circulating IGF-1 and regulate its bioavailability. The result is greatly enhanced free IGF-1 receptor activation and biological potency compared to native IGF-1. IGF-1 LR3 is also referred to as Long R3 IGF-1 or Long Arg3 IGF-1.

Property Value
Molecular Formula C400H625N111O115S9
Molecular Weight 9111.4 Da
CAS Number 946870-92-4
Structure 83 amino acid IGF-1 analog with Arg3 substitution and 13-aa N-terminal extension
Research Status Preclinical

Research Overview

IGF-1 LR3 has been investigated in preclinical research spanning cell biology, tissue engineering, and growth factor pharmacology. The primary mechanism involves activation of the IGF-1 receptor (IGF-1R), a receptor tyrosine kinase that signals through the PI3K/Akt and MAPK/ERK pathways to promote cellular proliferation, differentiation, and survival while inhibiting apoptosis.

The dramatically reduced IGFBP binding results in approximately 2-3 fold greater potency than native IGF-1 in cell culture systems, making IGF-1 LR3 the preferred form for in vitro research applications where consistent, maximal IGF-1 receptor activation is desired.

Key areas of published research include:

  • Cell Culture and Tissue Engineering: IGF-1 LR3 is widely used as a cell culture supplement in biopharmaceutical manufacturing and tissue engineering, where its enhanced bioavailability and resistance to IGFBP sequestration provide more consistent and potent growth factor stimulation than native IGF-1.
  • IGF-1 Receptor Signaling: The compound serves as a valuable research tool for studying IGF-1R activation, downstream PI3K/Akt signaling, and the biological consequences of sustained IGF-1 receptor stimulation in the absence of IGFBP-mediated regulation.
  • IGFBP Biology: IGF-1 LR3’s reduced IGFBP binding makes it useful for dissecting the relative contributions of IGF-1 receptor activation versus IGFBP-dependent effects in various biological systems.

IGF-1 LR3 is a preclinical research tool with no regulatory approvals for therapeutic use.

Specifications

All IGF-1 LR3 supplied by Prescott Bio Canada is manufactured to research-grade standards.

Specification Detail
Purity >98% (HPLC)
Form Lyophilized powder
Appearance White to off-white powder
Storage (lyophilized) -20°C, protected from light
Storage (reconstituted) 2-8°C, use within 30 days
Solubility Soluble in sterile water or appropriate buffer (slightly acidic pH recommended)

Each vial is accompanied by a Certificate of Analysis (COA) documenting purity, identity, and endotoxin testing.

Research Applications

IGF-1 LR3 is supplied exclusively for in vitro and in vivo laboratory research. Published experimental applications include:

  • Cell culture supplementation and biopharmaceutical manufacturing
  • IGF-1 receptor signaling and PI3K/Akt pathway research
  • Tissue engineering and regenerative medicine studies
  • IGFBP biology and IGF-1 bioavailability research
  • Cellular proliferation, differentiation, and survival studies
  • Comparative studies with native IGF-1 and other growth factors

Researchers should consult the primary literature and institutional review protocols before designing experiments with IGF-1 LR3.

Storage and Handling

Lyophilized powder: Store at -20°C in the original sealed vial, protected from light and moisture. Under these conditions, IGF-1 LR3 maintains stability for up to 24 months.

Reconstituted solution: Reconstitute with sterile water or slightly acidic buffer (pH 3-4) for optimal stability. For cell culture use, dilute into culture medium immediately before use. Store reconstituted IGF-1 LR3 at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles.

Handling precautions: This product is intended for research use only (RUO). Not for human or veterinary diagnostic or therapeutic use. Handle using standard laboratory safety practices including appropriate PPE.

Additional information

Size

1mg

Published Research

3 references

References are provided for informational purposes to support in vitro laboratory research. No claims are made regarding therapeutic applications.

Insulin-like growth factor (IGF) binding protein-3 (IGFBP-3) potentiates the growth-promoting activity of des(1-3)IGF-I and LR3IGF-I in vitro

Francis GL, Ross M, Ballard FJ, et al. (1992). Journal of Endocrinology

Long R3 IGF-I as a more potent alternative to native IGF-I for promoting cell growth in culture

Francis GL, Aplin SE, Milner SJ, et al. (1993). In Vitro Cellular and Developmental Biology – Animal

Cell culture applications of IGF-1 LR3 in biopharmaceutical manufacturing

Various industry groups (2000). Various industry publications

For laboratory research use only (in vitro). Not for human or animal use.

Save $39.25$156.99 $117.74

Not ready to pre-order? Enter your email and we'll notify you when this product is back in stock.

One-time notification. No spam, unsubscribe anytime.

Research Use Certification

This website supplies laboratory reference materials intended solely for in vitro research purposes. By entering, you confirm: