Laboratory research materials for in vitro use only.

$20 flat-rate shipping across Canada  ·  Free shipping on orders over $350

Dual Incretin Analog (39-aa)

For laboratory research use only (in vitro). Not for human or animal use.

15% OFF Create an account and get 15% off your first order
Select Size — Price Per Vial

Volume Pricing

QuantityDiscountUnit Price
1-2 unitsStandard$59.00Your price
3-4 units5% off$56.05Your price
5-9 units10% off$53.10Your price
10+ units Best Value15% off$50.15Your price

25% Pre-Order Discount Applied

The 25% pre-order discount is the maximum available and overrides volume pricing. There is no additional volume discount.

Pay via Interac e-Transfer

Why researchers choose PBC:

  • HPLC-verified purity on every lot
  • Certificate of Analysis included
  • Temperature-controlled shipping
  • Canadian lab — documented supply chain
  • Batch-level traceability

Accepted payment methods:

Interac e-Transfer

Certificate of Analysis available upon request. Contact us for lot-specific documentation.

Product Specifications

Amino Acid Sequence Y(Aib)EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C20 fatty diacid at Lys20
Molecular Weight 4813.45 Da
Molecular Formula C225H348N48O68
CAS Number 2023788-19-2
Purity ≥98% (HPLC)
Format Lyophilized Powder
Vials Per Kit 10
Storage Store at -20C. Reconstituted: 2-8C
Research Status Approved

For laboratory research use only (in vitro). Not for human or animal use.

Description

Chemical Identity

Dual Incretin Analog (39-aa) is a first-in-class dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist with the molecular formula C225H348N48O68 and a molecular weight of approximately 4813.45 Da. Also known as tirzepatide in the research literature, this 39-amino acid synthetic peptide features a C20 fatty diacid side chain attached via a linker at lysine-20, enabling albumin binding for extended pharmacokinetic duration. It was developed by Eli Lilly as a novel dual incretin receptor agonist.

Dual Incretin Analog (39-aa) is also known by the following research designations: LY3298176, Mounjaro, Zepbound.

Property Value
Molecular Formula C225H348N48O68
Molecular Weight 4813.45 Da
CAS Number 2023788-19-2
Sequence Tyr(Aib)EGTFTSDVSSYLEGQAAKEFIAWLVKGR(C20 fatty diacid via Lys20-linker)-NH2
Research Status FDA Approved

Research Overview

Dual Incretin Analog (39-aa), widely known as tirzepatide in published research, has been investigated in one of the largest Phase 3 clinical development programs in metabolic medicine, encompassing the SURPASS (type 2 diabetes) and SURMOUNT (obesity/overweight) trial series. The primary mechanism of action involves dual agonism at both the GIP receptor and GLP-1 receptor, with approximately 5-fold greater potency at GIPR relative to native GIP and complementary GLP-1R activation that enhances glucose-dependent insulin secretion, suppresses glucagon, slows gastric emptying, and reduces appetite through hypothalamic signaling.

Key areas of published research include:

  • Weight Management: The SURMOUNT-1 Phase 3 trial enrolled 2,539 adults with obesity or overweight and demonstrated unprecedented mean body weight reductions of 15.0%, 19.5%, and 20.9% across ascending dose groups versus 3.1% with placebo at 72 weeks. Up to 36% of participants achieved 25% or more weight loss at the highest dose. SURMOUNT-2 confirmed these findings in the harder-to-treat diabetic population with 12.8-14.7% weight reduction.
  • Glycemic Control: The SURPASS-1 trial demonstrated HbA1c reductions of 1.87-2.07% versus 0.04% with placebo in treatment-naive type 2 diabetes patients, with up to 52% of patients achieving HbA1c below the normal threshold of 5.7%. SURPASS-2 demonstrated superiority over a comparator GLP-1 receptor agonist for both HbA1c reduction and weight loss.
  • Cardiometabolic Parameters: Across the clinical program, Dual Incretin Analog (39-aa) demonstrated significant improvements in waist circumference, blood pressure, lipid profiles, and inflammatory markers beyond its effects on glycemia and body weight.

This compound received FDA approval as a branded product for type 2 diabetes (May 2022) and chronic weight management (November 2023). The clinical evidence base is extensive, with multiple large-scale Phase 3 randomized controlled trials enrolling thousands of participants.

Specifications

All Dual Incretin Analog (39-aa) supplied by Prescott Bio Canada is manufactured to research-grade standards.

Specification Detail
Purity >98% (HPLC)
Form Lyophilized powder
Appearance White to off-white powder
Storage (lyophilized) -20°C, protected from light
Storage (reconstituted) 2-8°C, use within 30 days
Solubility Soluble in bacteriostatic water, sterile water, or normal saline

Each vial is accompanied by a Certificate of Analysis (COA) documenting purity, identity, and endotoxin testing.

Research Applications

Dual Incretin Analog (39-aa) is supplied exclusively for in vitro and in vivo laboratory research. Published experimental applications include:

  • Investigation of dual GIP/GLP-1 receptor signaling synergy in metabolic models
  • Assessment of incretin-mediated insulin secretion and glucagon suppression pathways
  • Study of central appetite regulation through hypothalamic GLP-1 and GIP receptor activation
  • Evaluation of visceral adipose tissue metabolism and cardiometabolic risk factor modification

Researchers should consult the primary literature and institutional review protocols before designing experiments with Dual Incretin Analog (39-aa).

Storage and Handling

Lyophilized powder: Store at -20°C in the original sealed vial, protected from light and moisture. Under these conditions, Dual Incretin Analog (39-aa) maintains stability for up to 24 months.

Reconstituted solution: Reconstitute with bacteriostatic water or sterile water to the desired concentration. Store reconstituted Dual Incretin Analog (39-aa) at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles.

Handling precautions: This product is intended for research use only (RUO). Not for human or veterinary diagnostic or therapeutic use. Handle using standard laboratory safety practices including appropriate PPE.

Additional information

Size

2mg, 5mg, 10mg, 15mg, 20mg, 30mg, 40mg, 45mg, 50mg, 60mg, 70mg, 80mg, 90mg, 100mg, 110mg, 120mg

Published Research

No published references available for this compound.

Research Use Certification

This website supplies laboratory reference materials intended solely for in vitro research purposes. By entering, you confirm: