Laboratory research materials for in vitro use only.

$20 flat-rate shipping across Canada  ·  Free shipping on orders over $350

GLP-1 Analog (31-aa)

For laboratory research use only (in vitro). Not for human or animal use.

15% OFF Create an account and get 15% off your first order
Select Size — Price Per Vial

Volume Pricing

QuantityDiscountUnit Price
1-2 unitsStandard$89.99Your price
3-4 units5% off$85.49Your price
5-9 units10% off$80.99Your price
10+ units Best Value15% off$76.49Your price

25% Pre-Order Discount Applied

The 25% pre-order discount is the maximum available and overrides volume pricing. There is no additional volume discount.

Pay via Interac e-Transfer

Why researchers choose PBC:

  • HPLC-verified purity on every lot
  • Certificate of Analysis included
  • Temperature-controlled shipping
  • Canadian lab — documented supply chain
  • Batch-level traceability

Accepted payment methods:

Interac e-Transfer

Certificate of Analysis available upon request. Contact us for lot-specific documentation.

Product Specifications

Amino Acid Sequence H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG with C18 fatty diacid at Lys26
Molecular Weight 4113.58 Da
Molecular Formula C187H291N45O59
CAS Number 910463-68-2
Purity ≥98% (HPLC)
Format Lyophilized Powder
Vials Per Kit 10
Storage Store at -20C. Reconstituted: 2-8C
Research Status Approved

For laboratory research use only (in vitro). Not for human or animal use.

Description

Chemical Identity

GLP-1 Analog (31-aa) is a synthetic 31-amino acid peptide with the molecular formula C187H291N45O59 and a molecular weight of 4113.58 Da (CAS number 910463-68-2). The compound features an Aib (alpha-aminoisobutyric acid) substitution at position 8 for DPP-IV resistance and a C18 fatty diacid moiety attached at Lys26 that enables non-covalent albumin binding, extending the pharmacokinetic half-life to approximately 7 days. This GLP-1 analog is also known as semaglutide in the research literature and has been investigated as a glucagon-like peptide-1 receptor agonist.

GLP-1 Analog (31-aa) represents an advanced incretin mimetic designed for once-weekly administration, with both subcutaneous and oral formulations having been developed and studied in clinical trials.

Property Value
Molecular Formula C187H291N45O59
Molecular Weight 4113.58 Da
CAS Number 910463-68-2
Key Modifications Aib8 substitution; C18 fatty diacid at Lys26
Research Status FDA-approved (multiple indications)

Research Overview

GLP-1 Analog (31-aa) has been extensively investigated across clinical development programs for type 2 diabetes, obesity, and cardiovascular disease. The primary mechanism involves potent agonism of the GLP-1 receptor (GLP-1R), a class B GPCR expressed in pancreatic beta cells, the central nervous system, the gastrointestinal tract, and the cardiovascular system. GLP-1R activation stimulates glucose-dependent insulin secretion, suppresses glucagon release, slows gastric emptying, and activates hypothalamic satiety centers to reduce appetite and food intake.

The fatty acid-mediated albumin binding provides the extended pharmacokinetic profile that enables once-weekly dosing, while the Aib8 substitution prevents inactivation by DPP-IV, the enzyme that rapidly degrades native GLP-1.

Key areas of published research include:

  • Weight Management: Clinical trials have demonstrated substantial body weight reduction in obese participants, with Phase 3 studies reporting mean weight loss of approximately 15-17% from baseline at 68 weeks, establishing GLP-1 Analog (31-aa) as one of the most effective pharmacological interventions for obesity.
  • Type 2 Diabetes: Extensive clinical programs have demonstrated significant HbA1c reductions with a favorable safety profile, leading to regulatory approvals for glycemic control in type 2 diabetes.
  • Cardiovascular Outcomes: The SELECT trial demonstrated significant reduction in major adverse cardiovascular events in overweight/obese adults, expanding the compound’s clinical utility beyond metabolic disease into cardiovascular risk reduction.

GLP-1 Analog (31-aa) has received regulatory approvals for type 2 diabetes and obesity management. Research-grade material is available for preclinical studies.

Specifications

All GLP-1 Analog (31-aa) supplied by Prescott Bio Canada is manufactured to research-grade standards.

Specification Detail
Purity >98% (HPLC)
Form Lyophilized powder
Appearance White to off-white powder
Storage (lyophilized) -20°C, protected from light
Storage (reconstituted) 2-8°C, use within 30 days
Solubility Soluble in sterile water or appropriate buffer

Each vial is accompanied by a Certificate of Analysis (COA) documenting purity, identity, and endotoxin testing.

Research Applications

GLP-1 Analog (31-aa) is supplied exclusively for in vitro and in vivo laboratory research. Published experimental applications include:

  • GLP-1 receptor signaling and incretin pathway research
  • Metabolic disease and obesity mechanism studies
  • Pancreatic beta cell function and insulin secretion research
  • Central appetite regulation and hypothalamic signaling studies
  • Cardiovascular outcome and cardioprotection research
  • Comparative studies with other incretin mimetics and dual/triple agonists

Researchers should consult the primary literature and institutional review protocols before designing experiments with GLP-1 Analog (31-aa).

Storage and Handling

Lyophilized powder: Store at -20°C in the original sealed vial, protected from light and moisture. Under these conditions, GLP-1 Analog (31-aa) maintains stability for up to 24 months.

Reconstituted solution: Reconstitute with sterile water or appropriate buffer. Store reconstituted GLP-1 Analog (31-aa) at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles.

Handling precautions: This product is intended for research use only (RUO). Not for human or veterinary diagnostic or therapeutic use. Handle using standard laboratory safety practices including appropriate PPE.

Additional information

Size

2mg, 5mg, 10mg, 15mg, 20mg, 30mg

Published Research

4 references

References are provided for informational purposes to support in vitro laboratory research. No claims are made regarding therapeutic applications.

Glucagon-like peptide 1 promotes satiety and suppresses energy intake in humans

Flint A, Raben A, Astrup A, Holst JJ (1998). Journal of Clinical Investigation. PubMed 9449682

Liraglutide and Cardiovascular Outcomes in Type 2 Diabetes (LEADER)

Marso SP, Daniels GH, Tanaka-Taketomi K, et al. (2016). New England Journal of Medicine. PubMed 27295427

Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1)

Wilding JPH, Batterham RL, Calanna S, et al. (2021). New England Journal of Medicine. PubMed 33567185

Tirzepatide Once Weekly for the Treatment of Obesity (SURMOUNT-1)

Jastreboff AM, Aronne LJ, Ahmad NN, et al. (2022). New England Journal of Medicine. PubMed 35658024

For laboratory research use only (in vitro). Not for human or animal use.

Research Use Certification

This website supplies laboratory reference materials intended solely for in vitro research purposes. By entering, you confirm: