Laboratory research materials for in vitro use only.

$20 flat-rate shipping across Canada  ·  Free shipping on orders over $350

Retatrutide

For laboratory research use only (in vitro). Not for human or animal use.

15% OFF Create an account and get 15% off your first order
Select Size — Price Per Vial
In Stock — Ships Today
Restock — Pre-Order (25% Off)

Volume Pricing

QuantityDiscountUnit Price
1-2 unitsStandard$88.99Your price
3-4 units5% off$84.54Your price
5-9 units10% off$80.09Your price
10+ units Best Value15% off$75.64Your price

25% Pre-Order Discount Applied

The 25% pre-order discount is the maximum available and overrides volume pricing. There is no additional volume discount.

Pay via Interac e-Transfer

Why researchers choose PBC:

  • HPLC-verified purity on every lot
  • Certificate of Analysis included
  • Temperature-controlled shipping
  • Canadian lab — documented supply chain
  • Batch-level traceability

Accepted payment methods:

Interac e-Transfer

Certificate of Analysis available upon request. Contact us for lot-specific documentation.

Product Specifications

Amino Acid Sequence His(Aib)QGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C18 fatty acid at Lys30
Molecular Weight 4731.41 Da
Molecular Formula C221H342N46O68
CAS Number 2381089-83-2
Purity ≥98% (HPLC)
Format Lyophilized Powder
Vials Per Kit 10
Storage Store at -20C. Reconstituted: 2-8C
Research Status Phase3

For laboratory research use only (in vitro). Not for human or animal use.

Description

Chemical Identity

Retatrutide is a synthetic peptide with the molecular formula C221H342N46O68 and a molecular weight of 4731.41 Da (CAS number 2381089-83-2). Developed by Eli Lilly under the code LY3437943, Retatrutide is the first triple incretin receptor agonist, simultaneously activating GLP-1, GIP, and glucagon receptors. The amino acid sequence is His(Aib)QGTFTSDVSSYLEGQAAKEFIAWLVKGR with a C18 fatty acid side chain attached via a linker at Lys30 for albumin binding and once-weekly dosing.

Retatrutide represents a novel class of multi-receptor agonists designed to engage three complementary metabolic pathways simultaneously for enhanced weight loss and metabolic improvement.

Property Value
Molecular Formula C221H342N46O68
Molecular Weight 4731.41 Da
CAS Number 2381089-83-2
Mechanism Triple agonist: GLP-1R + GIPR + Glucagon receptor
Research Status Phase 3 clinical trials

Research Overview

Retatrutide has been investigated in Phase 2 clinical trials with Phase 3 trials ongoing, demonstrating unprecedented weight loss results among incretin-based compounds. The tri-agonist mechanism engages three complementary metabolic pathways: GLP-1 receptor activation reduces appetite and slows gastric emptying; GIP receptor activation enhances insulin secretion and may contribute to adipose tissue metabolism; glucagon receptor activation increases energy expenditure, hepatic lipid oxidation, and thermogenesis.

The addition of glucagon receptor agonism distinguishes Retatrutide from dual agonists like tirzepatide, providing a mechanism for increased energy expenditure that complements the appetite-suppressing effects of GLP-1R and GIPR activation.

Key areas of published research include:

  • Weight Loss Efficacy: Phase 2 trial results demonstrated up to 24.2% body weight reduction at 48 weeks at the highest dose, exceeding results achieved by dual agonists in comparable trial designs and representing the largest weight reduction reported for any pharmacological intervention at that time.
  • Metabolic Improvement: Clinical data showed significant improvements in glycemic control, insulin sensitivity, and lipid profiles, supporting the multi-receptor approach for comprehensive metabolic disease management.
  • Triple Receptor Pharmacology: Retatrutide has been instrumental in establishing the therapeutic rationale for triple incretin agonism, demonstrating that glucagon receptor activation contributes meaningfully to weight loss through enhanced energy expenditure.

Retatrutide is currently in Phase 3 clinical development. No regulatory approvals have been granted.

Specifications

All Retatrutide supplied by Prescott Bio Canada is manufactured to research-grade standards.

Specification Detail
Purity >98% (HPLC)
Form Lyophilized powder
Appearance White to off-white powder
Storage (lyophilized) -20°C, protected from light
Storage (reconstituted) 2-8°C, use within 30 days
Solubility Soluble in sterile water or appropriate buffer

Each vial is accompanied by a Certificate of Analysis (COA) documenting purity, identity, and endotoxin testing.

Research Applications

Retatrutide is supplied exclusively for in vitro and in vivo laboratory research. Published experimental applications include:

  • Triple incretin receptor agonism and multi-receptor pharmacology research
  • Glucagon receptor-mediated energy expenditure and thermogenesis studies
  • Obesity and metabolic disease pathway research
  • Comparative studies with dual (GLP-1/GIP) and single receptor agonists
  • Hepatic lipid metabolism and NAFLD/NASH research

Researchers should consult the primary literature and institutional review protocols before designing experiments with Retatrutide.

Storage and Handling

Lyophilized powder: Store at -20°C in the original sealed vial, protected from light and moisture. Under these conditions, Retatrutide maintains stability for up to 24 months.

Reconstituted solution: Reconstitute with sterile water or appropriate buffer. Store reconstituted Retatrutide at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles.

Handling precautions: This product is intended for research use only (RUO). Not for human or veterinary diagnostic or therapeutic use. Handle using standard laboratory safety practices including appropriate PPE.

Additional information

Size

5mg, 10mg, 12mg, 15mg, 20mg, 30mg, 40mg, 50mg, 60mg

Published Research

3 references

References are provided for informational purposes to support in vitro laboratory research. No claims are made regarding therapeutic applications.

Triple-hormone-receptor agonist retatrutide for obesity – a phase 2 trial

Jastreboff AM, Kaplan LM, Frias JP, et al. (2023). New England Journal of Medicine. PubMed 37366315

Retatrutide, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes: a randomised, double-blind, placebo and active-comparator controlled, parallel-group, phase 2 trial conducted in the USA

Rosenstock J, Frias JP, Jastreboff AM, et al. (2023). The Lancet. PubMed 37385280

LY3437943, a novel triple GIP, GLP-1, and glucagon receptor agonist in people with type 2 diabetes: a phase 1, randomised, double-blind, placebo-controlled and active comparator-controlled trial

Coskun T, Urva S, Roell WC, et al. (2022). Cell Metabolism. PubMed 35985340

For laboratory research use only (in vitro). Not for human or animal use.

Research Use Certification

This website supplies laboratory reference materials intended solely for in vitro research purposes. By entering, you confirm: